PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0135189.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 140aa    MW: 16357.7 Da    PI: 9.9893
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0135189.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.86.1e-212990157
                     TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     ++ R+++t+eq++ L elF+   r+ps++++++++++l    +++ ++V++WFqN++a+e++
  Lj0g3v0135189.1 29 KCGRWNPTTEQVKLLTELFRAgLRTPSTDQIQKISNQLsfygKIESKNVFYWFQNHKARERQ 90
                     568*****************99**************************************97 PP

2Wus_type_Homeobox113.61e-362992265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++ RW+Pt+eQ+k+L+el+++GlrtP++++iq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+
    Lj0g3v0135189.1 29 KCGRWNPTTEQVKLLTELFRAGLRTPSTDQIQKISNQLSFYGKIESKNVFYWFQNHKARERQKR 92
                       678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.0942691IPR001356Homeobox domain
SMARTSM003897.5E-42895IPR001356Homeobox domain
PfamPF000465.9E-183090IPR001356Homeobox domain
SuperFamilySSF466895.56E-123194IPR009057Homeodomain-like
CDDcd000863.81E-53292No hitNo description
Gene3DG3DSA:1.10.10.602.6E-83290IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MEEGNMSGFC IRSGSCTVRG KSGISSGTKC GRWNPTTEQV KLLTELFRAG LRTPSTDQIQ  60
KISNQLSFYG KIESKNVFYW FQNHKARERQ KRRKVSYDEK DVVIRRDNFM NASPLSKYYC  120
HLHVCVHIHI FQNQLCHKCY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014504325.13e-61PREDICTED: WUSCHEL-related homeobox 5
SwissprotQ8H1D24e-45WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLG7KBY34e-61G7KBY3_MEDTR; Uncharacterized protein
STRINGGLYMA02G42200.12e-54(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60143452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.13e-46WUSCHEL related homeobox 5